PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_4533_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 127aa    MW: 14145.5 Da    PI: 8.6448
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_4533_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.25.9e-301059251
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   rienk+ rqvtfskRr+g+lKKA+E+SvLCda+va+i+fs++gkl+eys+
  Neem_4533_f_3 10 RIENKISRQVTFSKRRAGLLKKAHEISVLCDADVALIVFSTKGKLFEYST 59
                   8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004326.0E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.29E-28263IPR002100Transcription factor, MADS-box
CDDcd002653.42E-39261No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-30323IPR002100Transcription factor, MADS-box
PfamPF003198.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGRGRVQLRR IENKISRQVT FSKRRAGLLK KAHEISVLCD ADVALIVFST KGKLFEYSTD  60
SRSVPVLYFE LETLFNQQSL LCMLLGAWFL TKDPGALCCW GLLYFTLLGE EDNLPNVSSA  120
SGGLQPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A2e-19270170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-19270170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-19270170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D2e-19270170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A4e-19270170Myocyte-specific enhancer factor 2A
3kov_B4e-19270170Myocyte-specific enhancer factor 2A
3kov_I4e-19270170Myocyte-specific enhancer factor 2A
3kov_J4e-19270170Myocyte-specific enhancer factor 2A
3p57_A4e-19270170Myocyte-specific enhancer factor 2A
3p57_B4e-19270170Myocyte-specific enhancer factor 2A
3p57_C4e-19270170Myocyte-specific enhancer factor 2A
3p57_D4e-19270170Myocyte-specific enhancer factor 2A
3p57_I4e-19270170Myocyte-specific enhancer factor 2A
3p57_J4e-19270170Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006430951.11e-35hypothetical protein CICLE_v10012594mg
RefseqXP_006482431.11e-35PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X1
RefseqXP_006482432.11e-35PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
TrEMBLV4T3U91e-35V4T3U9_9R
STRINGVIT_14s0083g01030.t015e-34(Vitis vinifera)
STRINGPOPTR_0004s11430.16e-35(Populus trichocarpa)
STRINGPOPTR_0012s05950.12e-35(Populus trichocarpa)
STRINGPOPTR_0017s13400.13e-35(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-35MIKC_MADS family protein